PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG100100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 267aa    MW: 28480.1 Da    PI: 8.8563
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG100100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.77e-17107159254
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          rk+ ++tkeq   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa 
  Pavir.9KG100100.1.p 107 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRAS 159
                          788899*********************************************96 PP

2HD-ZIP_I/II115.82.6e-37107200191
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRA....RtktkqlEkdyeaLkraydalkeenerLekevee 86 
                          +kk+rl+keq++lLE+ F+e+++L+p++Kv+la++L+l+prqv+vWFqnrRA    Rtk+kq+E+d+e+Lkr++++l+een+rL++e +e
  Pavir.9KG100100.1.p 107 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRAsrarRTKLKQTEVDCEFLKRCCESLTEENRRLQRELQE 196
                          69*************************************************988889********************************* PP

          HD-ZIP_I/II  87 Lreel 91 
                          Lr +l
  Pavir.9KG100100.1.p 197 LR-AL 200
                          *9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-1794157IPR009057Homeodomain-like
SuperFamilySSF466895.85E-17101159IPR009057Homeodomain-like
PROSITE profilePS5007116.52103163IPR001356Homeobox domain
SMARTSM003891.2E-14105167IPR001356Homeobox domain
PfamPF000462.9E-14107159IPR001356Homeobox domain
CDDcd000863.34E-14107165No hitNo description
CDDcd146860.00494154199No hitNo description
PfamPF021833.1E-11167201IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.3E-23167210IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MAQEDVHLDD AGLALGLSLG GGAAPDAARR QGAGARLPPS PRALEPSLTL SMPDEATATG  60
SAGGGAAHSV SSSLPAAGVK RERVEEADGE RASSTARAED DDDGSTRKKL RLTKEQSALL  120
EDRFKEHSTL NPKQKVALAK QLNLRPRQVE VWFQNRRASR ARRTKLKQTE VDCEFLKRCC  180
ESLTEENRRL QRELQELRAL KFAAPPGPAA PAPAPLYMQL PAATLTLCPS CERLGGPAAA  240
AKADPDRPKA APAHHFFNPF THSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105111TRKKLRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0357541e-103BT035754.2 Zea mays full-length cDNA clone ZM_BFb0081O05 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985118.11e-129PREDICTED: homeobox-leucine zipper protein HOX19 isoform X1
SwissprotA2XE761e-104HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL41e-104HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLA0A096S3011e-112A0A096S301_MAIZE; Uncharacterized protein
STRINGGRMZM2G126808_P021e-111(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-46homeobox from Arabidopsis thaliana